missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTPRD Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
214.00 € - 506.00 €
Specifications
| Antigen | PTPRD |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:100-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18650272
|
Novus Biologicals
NBP2-94767-0.02ml |
0.02 mL |
214.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18679201
|
Novus Biologicals
NBP2-94767-0.1ml |
0.1 mL |
506.00 €
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PTPRD Polyclonal antibody specifically detects PTPRD in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| PTPRD | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 5789 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:100-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| HPTPDELTA, HPTPMGC119752, MGC119750, MGC119751, protein tyrosine phosphatase, receptor type, D, Protein-tyrosine phosphatase delta, PTPDMGC119753, receptor type, delta polypeptide, receptor-type tyrosine-protein phosphatase delta | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 475-574 of human PTPRD (NP_002830.1). QITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title