missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTPRD Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94767-0.1ml
This item is not returnable.
View return policy
Description
PTPRD Polyclonal antibody specifically detects PTPRD in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| PTPRD | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:100-1:200, Immunohistochemistry-Paraffin | |
| HPTPDELTA, HPTPMGC119752, MGC119750, MGC119751, protein tyrosine phosphatase, receptor type, D, Protein-tyrosine phosphatase delta, PTPDMGC119753, receptor type, delta polypeptide, receptor-type tyrosine-protein phosphatase delta | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 475-574 of human PTPRD (NP_002830.1). QITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQG | |
| 0.1 mL | |
| Neuroscience, Signal Transduction | |
| 5789 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction