missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human OSBPL7 Partial ORF (NP_665741.1, 742 a.a. - 842 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00114881-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16181437

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
22-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Two transcript variants encoding the same isoform have been identified. [provided by RefSeq]

Sequence: ELNELTAELKRSLPSTDTRLRPDQRYLEEGNIQAAEAQKRRIEQLQRDRRKVMEENNIVHQARFFRRQTDSSGKEWWVTNNTYWRLRAEPGYGNMDGAVLW
Spezifikation

Spezifikation

NP_665741.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.85kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ELNELTAELKRSLPSTDTRLRPDQRYLEEGNIQAAEAQKRRIEQLQRDRRKVMEENNIVHQARFFRRQTDSSGKEWWVTNNTYWRLRAEPGYGNMDGAVLW
RUO
OSBPL7
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
114881
OSBPL7 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC71150|ORP7
OSBPL7
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation