missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human METTL2 Partial ORF (NP_060866.1, 41 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00055798-Q01.10ug
This item is not returnable.
View return policy
Description
This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq]
Sequence: SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICADSpecifications
| NP_060866.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.22kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICAD | |
| RUO | |
| METTL2B | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 55798 | |
| METTL2 (Human) Recombinant Protein (Q01) | |
| 10 μg | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ11350/FLJ12760/METL/METTL2/METTL2A/PSENIP1 | |
| METTL2B | |
| Recombinant | |
| wheat germ expression system |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction