missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human METTL2 Partial ORF (NP_060866.1, 41 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00 € - 508.00 €

Specifications

Accession Number NP_060866.1
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 55798
Molecular Weight (g/mol) 33.22kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16138386
View Documents Promotion Details
Abnova™
H00055798-Q01.10UG
10 ug
335.00 €
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16148386
View Documents Promotion Details
Abnova™
H00055798-Q01.25UG
25 ug
508.00 €
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq]

Sequence: SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICAD
Specifications

Specifications

NP_060866.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.22kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ11350/FLJ12760/METL/METTL2/METTL2A/PSENIP1
METTL2B
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
55798
METTL2 (Human) Recombinant Protein (Q01)
SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICAD
RUO
METTL2B
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications