missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 456.00 €
Specifications
| Antigen | CDK4 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18213944
|
Novus Biologicals
NBP2-58877 |
100 μL |
456.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18629057
|
Novus Biologicals
NBP2-58877-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CDK4 Polyclonal specifically detects CDK4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| CDK4 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Cycle and Replication, Core ESC Like Genes, mTOR Pathway, Protein Kinase, Stem Cell Markers | |
| Cell division protein kinase 4, CMM3, cyclin-dependent kinase 4, EC 2.7.11, EC 2.7.11.22, melanoma cutaneous malignant, 3, MGC14458, PSK-J3cell division kinase 4 | |
| CDK4 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 1019 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title