missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58877-25ul
This item is not returnable.
View return policy
Description
CDK4 Polyclonal specifically detects CDK4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| CDK4 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| Cell division protein kinase 4, CMM3, cyclin-dependent kinase 4, EC 2.7.11, EC 2.7.11.22, melanoma cutaneous malignant, 3, MGC14458, PSK-J3cell division kinase 4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide | |
| CDK4 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE | |
| 25 μL | |
| Cancer, Cell Cycle and Replication, Core ESC Like Genes, mTOR Pathway, Protein Kinase, Stem Cell Markers | |
| 1019 | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction