missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BRCA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
307.00 € - 563.00 €
Specifications
| Antigen | BRCA2 |
|---|---|
| Dilution | Western Blot Reported in scientific literature (PMID: 30250272)., Flow Cytometry Reported in scientific literature (PMID: 28904740)., Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin Reported in scientific literature ( PMID: 32529018). |
| Applications | Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18495451
|
Novus Biologicals
NBP1-88361-25ul |
25 μL |
307.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18775623
|
Novus Biologicals
NBP1-88361 |
563.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
BRCA2 Polyclonal specifically detects BRCA2 in Human samples. It is validated for Western Blot, Flow Cytometry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| BRCA2 | |
| Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P51587 | |
| 675 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot Reported in scientific literature (PMID: 30250272)., Flow Cytometry Reported in scientific literature (PMID: 28904740)., Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin Reported in scientific literature ( PMID: 32529018). | |
| Polyclonal | |
| Rabbit | |
| Breast Cancer, Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BRCA1/BRCA2-containing complex, subunit 2, BRCC2, breast and ovarian cancer susceptibility gene, early onset, breast cancer 2 tumor suppressor, breast cancer 2, early onset, breast cancer susceptibility protein BRCA2, breast cancer type 2 susceptibility protein, BROVCA2, FACD, FAD, FAD1, FANCB, FANCD, FANCD1Fanconi anemia, complementation group D1, Fanconi anemia group D1 protein, GLM3, PNCA2 | |
| BRCA2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title