missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ANO7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00 € - 539.00 €
Specifications
| Antigen | ANO7 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18450281
|
Novus Biologicals
NBP1-83099-25ul |
25 μL |
433.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18236558
|
Novus Biologicals
NBP1-83099 |
0.1 mL |
539.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ANO7 Polyclonal specifically detects ANO7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ANO7 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| anoctamin 7, Dresden transmembrane protein of the prostate, IPCA-5IPCA5, New gene expressed in prostate, NGEPD-TMPP, PCANAP5anoctamin-7, PCANAP5L, prostate cancer associated protein 5, prostate cancer-associated gene 5, Prostate cancer-associated protein 5, TMEM16GDresden-transmembrane protein of the prostate, Transmembrane protein 16GDTMPP | |
| ANO7 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q6IWH7 | |
| 50636 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title