missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ANO7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-83099
This item is not returnable.
View return policy
Description
ANO7 Polyclonal specifically detects ANO7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ANO7 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q6IWH7 | |
| ANO7 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| anoctamin 7, Dresden transmembrane protein of the prostate, IPCA-5IPCA5, New gene expressed in prostate, NGEPD-TMPP, PCANAP5anoctamin-7, PCANAP5L, prostate cancer associated protein 5, prostate cancer-associated gene 5, Prostate cancer-associated protein 5, TMEM16GDresden-transmembrane protein of the prostate, Transmembrane protein 16GDTMPP | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 50636 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction