missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ZNF238 Polyclonal antibody specifically detects ZNF238 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | ZNF238 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | NIZP1, NSD1 (nuclear receptor binding SET-domain containing 1)-interacting zinc fingerprotein 1, zinc finger protein 496, Zinc finger protein with KRAB and SCAN domains 17, ZKSCAN17MGC15548 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?