missing translation for 'onlineSavingsMsg'
Learn More
Learn More
XLF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65 € - 590.10 €
Specifications
| Antigen | XLF |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18241474
|
Novus Biologicals
NBP2-55106 |
100 μL |
624.00 € 590.10 € / 100µL Save 33.90 € 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18635417
|
Novus Biologicals
NBP2-55106-25ul |
25 μL |
415.00 € 391.65 € / 25µL Save 23.35 € 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
XLF Polyclonal specifically detects XLF in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| XLF | |
| Polyclonal | |
| Rabbit | |
| Cancer, Chromatin Research, DNA Repair | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 79840 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Cernunnos, non-homologous end-joining factor 1, nonhomologous end-joining factor 1, Protein cernunnos, XLFFLJ12610, XRCC4-like factor | |
| NHEJ1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title