missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
VPS54 Polyclonal specifically detects VPS54 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
Specifications
| Antigen | VPS54 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | HCC8SLP-8p, Hepatocellular carcinoma protein 8, hVps54L, Tumor antigen HOM-HCC-8, Tumor antigen SLP-8p, vacuolar protein sorting 54 (yeast), vacuolar protein sorting 54 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 54, VPS54L |
| Gene Symbols | VPS54 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKIHERCKNICPPKDTFERTLLHTHDKSRTDLEQVPKIFMKPDFALDDSLTFNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVN |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?