missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIM23 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-88846
This item is not returnable.
View return policy
Description
TRIM23 Polyclonal specifically detects TRIM23 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.
Specifications
| TRIM23 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ADP-ribosylation factor domain protein 1, 64kDa, ADP-ribosylation factor domain-containing protein 1, ARD1GTP-binding protein ARD-1, ARF domain protein 1, ARFD1, E3 ubiquitin-protein ligase TRIM23, EC 6.3.2.-, RNF46RING finger protein 46, tripartite motif containing 23, tripartite motif protein TRIM23, tripartite motif-containing 23, Tripartite motif-containing protein 23 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TRIM23 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST | |
| 0.1 mL | |
| Signal Transduction, Zinc Finger | |
| 373 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction