Learn More
Invitrogen™ VAChT Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA595404
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, HEPA whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene.
Specifications
| VAChT | |
| Polyclonal | |
| Unconjugated | |
| SLC18A3 | |
| MGC12716; rVAT; SLC18A3; solute carrier family 18 (vesicular acetylcholine transporter), member 3; solute carrier family 18 (vesicular acetylcholine), member 3; solute carrier family 18 (vesicular monoamine) member 3; solute carrier family 18 (vesicular monoamine), member 3; solute carrier family 18 member 3; solute carrier family 18 member A3; solute carrier family 18, member 3; VAChT; VAT; vesicular acetylcholine transporter | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 20508, 6572 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| O35304, Q16572 | |
| SLC18A3 | |
| A synthetic peptide corresponding to a sequence at the N-terminus of human SLC18A3 (1-36aa MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVL). | |
| 100 μg | |
| Primary | |
| Human, Mouse | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.