missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
USP18 Polyclonal antibody specifically detects USP18 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | USP18 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | DyLight 405 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | EC 3.1.2.15, EC 3.4.19.-, hUBP43, ISG15-specific-processing protease, ISG43UBP43, ubiquitin specific peptidase 18, ubiquitin specific protease 18, ubl carboxyl-terminal hydrolase 18, ubl thioesterase 18,43 kDa ISG15-specific protease, Ubl thiolesterase 18 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP18 (NP_059110.2).,, Sequence:, DVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?