missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UQCRQ Antibody - BSA Free, Novus Biologicals™

UQCRQ Antibody - BSA Free, Novus Biologicals™

Product Code. 18633991 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.01mL
0.02mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18633991 0.02 mL 0.02mL
18633451 0.1 mL 0.01mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18633991 Supplier Novus Biologicals Supplier No. NBP2935060.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beschreibung

Rabbit Polyclonal Antibody

UQCRQ Polyclonal antibody specifically detects UQCRQ in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen UQCRQ
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias complex III subunit 8, cytochrome b-c1 complex subunit 8, low molecular mass ubiquinone-binding protein (9.5kD), QPC, ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa, UQCR7
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-82 of human UQCRQ (NP_055217.2). MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cell Biology, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 27089
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.