missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TTC11 Polyclonal antibody specifically detects TTC11 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | TTC11 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 350 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | CGI-135, Fis1, FIS1 homolog, fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae), fission 1 (mitochondrial outer membrane) homolog (yeast), H_NH0132A01.6, hFis1, mitochondrial fission 1 protein, tetratricopeptide repeat domain 11, Tetratricopeptide repeat protein 11, TTC11TPR repeat protein 11 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11 (NP_057152.2).,, Sequence:, MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?