missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TRPM4 Antibody (CL11214), Novus Biologicals™

TRPM4 Antibody (CL11214), Novus Biologicals™

Product Code. 18613397 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18613397 100 μg 100µL
18629916 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18613397 Supplier Novus Biologicals Supplier No. NBP307990100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

TRPM4 Monoclonal antibody specifically detects TRPM4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen TRPM4
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL11214
Conjugate Unconjugated
Dilution Western Blot 1 μg/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 2-10 μg/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, containing 40% glycerol
Gene Alias Calcium-activated non-selective cation channel 1, FLJ20041, hTRPM4, Long transient receptor potential channel 4, LTrpC-4, LTRPC4, melastatin-4, PFHB1B, transient receptor potential cation channel subfamily M member 4, transient receptor potential cation channel, subfamily M, member 4, TRPM4B
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLLVAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKE
Purification Method Protein A purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Endocrinology, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 54795
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.