missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TRP7 Antibody - Azide and BSA Free, Novus Biologicals™

TRP7 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18686842 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18686842 0.02 mL 0.02mL
18642722 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18686842 Supplier Novus Biologicals Supplier No. NBP2943880.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TRP7 Polyclonal antibody specifically detects TRP7 in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen TRP7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias hTRP7, KNP3, likley ortholog of mouse transient receptor potential cation channel, subfamilyC, member 7, putative capacitative calcium channel, short transient receptor potential channel 7, transient receptor potential cation channel, subfamily C, member 7, transient receptor potential-related channel 7, a novel putative Ca2+ channelprotein10TRPM2, Transient receptor protein 7, TRP7, TRP-7, TrpC7
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 720-780 of human TRPC7 (NP_065122.1). YLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRY
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 57113
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.