missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TRP7 Polyclonal antibody specifically detects TRP7 in Human, Mouse samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | TRP7 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | hTRP7, KNP3, likley ortholog of mouse transient receptor potential cation channel, subfamilyC, member 7, putative capacitative calcium channel, short transient receptor potential channel 7, transient receptor potential cation channel, subfamily C, member 7, transient receptor potential-related channel 7, a novel putative Ca2+ channelprotein10TRPM2, Transient receptor protein 7, TRP7, TRP-7, TrpC7 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 720-780 of human TRPC7 (NP_065122.1). YLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRY |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?