missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIM23 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
280.00 € - 725.00 €
Specifications
| Antigen | TRIM23 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18431971
|
Novus Biologicals
NBP1-88846-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18208367
|
Novus Biologicals
NBP1-88846 |
0.1 mL |
725.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descrizione
TRIM23 Polyclonal specifically detects TRIM23 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifica
| TRIM23 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction, Zinc Finger | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 373 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| ADP-ribosylation factor domain protein 1, 64kDa, ADP-ribosylation factor domain-containing protein 1, ARD1GTP-binding protein ARD-1, ARF domain protein 1, ARFD1, E3 ubiquitin-protein ligase TRIM23, EC 6.3.2.-, RNF46RING finger protein 46, tripartite motif containing 23, tripartite motif protein TRIM23, tripartite motif-containing 23, Tripartite motif-containing protein 23 | |
| TRIM23 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto