missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500024

Topoisomerase I Antibody [CoraFluorÖ 1], Novus Biologicals Biologicals™

Product Code. 30500024 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity
30500024 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500024 Supplier Novus Biologicals Supplier No. NBP335246CL1

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Topoisomerase I Polyclonal antibody specifically detects Topoisomerase I in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Topoisomerase I
Applications ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate CoraFluor 1
Formulation PBS
Gene Alias DNA topoisomerase 1, DNA topoisomerase I, EC 5.99.1.2, TOPI, topoisomerase (DNA) I, type I DNA topoisomerase
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Topoisomerase I (Topoisomerase I (TOP1)) (NP_003277.1).,, Sequence:, MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, DNA Repair, DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 7150
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark. Do not freeze.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.