missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TLR6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Specifications
| Antigen | TLR6 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18268364
|
Novus Biologicals
NBP2-57646 |
100 μL |
593.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18681708
|
Novus Biologicals
NBP2-57646-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TLR6 Polyclonal specifically detects TLR6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TLR6 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Cytokine Research, Immunology, Innate Immunity, Prostate Cancer, Toll Like Receptors | |
| CD286, CD286 antigen, toll-like receptor 6 | |
| TLR6 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 10333 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVESIVVLNLSSNMLTD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title