missing translation for 'onlineSavingsMsg'
Learn More

TIMM10 Antibody - BSA Free, Novus Biologicals™

Product Code. 18677180 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18677180 0.02 mL 0.02mL
18689660 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18677180 Supplier Novus Biologicals Supplier No. NBP2931760.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

TIMM10 Polyclonal antibody specifically detects TIMM10 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen TIMM10
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000 - 1:5000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias mitochondrial import inner membrane translocase subunit Tim10, TIM10TIM10Atranslocase of inner mitochondrial membrane 10 (yeast) homolog, translocase of inner mitochondrial membrane 10 homolog (yeast)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TIMM10 (NP_036588.1). MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 26519
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.