missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUV39H2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38828-25ul
This item is not returnable.
View return policy
Description
SUV39H2 Polyclonal specifically detects SUV39H2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SUV39H2 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q9H5I1 | |
| SUV39H2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPI | |
| 25 μL | |
| Cell Cycle and Replication | |
| 79723 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ23414Histone H3-K9 methyltransferase 2, H3-K9-HMTase 2, histone-lysine N-methyltransferase SUV39H2, KMT1BEC 2.1.1.43, Lysine N-methyltransferase 1B, Su(var)3-9 homolog 2, Suppressor of variegation 3-9 homolog 2, suppressor of variegation 3-9 homolog 2 (Drosophila) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction