missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SSTK-IP Polyclonal antibody specifically detects SSTK-IP in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | SSTK-IP |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Accession No. | Q96A04 |
| Gene Alias | C1orf182, chromosome 1 open reading frame 182, MGC26877, RP11-443G18.5, SIP, SSTK-interacting protein (SSTK-IP), SSTK-IP |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLG |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?