missing translation for 'onlineSavingsMsg'
Learn More

SMCX Antibody [Alexa Fluor« 488], Novus Biologicals Biologicals™

Product Code. 30500639 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500639 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500639 Supplier Novus Biologicals Supplier No. NBP335594AF488

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SMCX Polyclonal antibody specifically detects SMCX in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SMCX
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 488
Formulation 50mM Sodium Borate
Gene Alias DXS1272EMRXJ, EC 1.14.11, EC 1.14.11.-, Histone demethylase JARID1C, JARID1Clysine-specific demethylase 5C, jumonji, AT rich interactive domain 1C, Jumonji, AT rich interactive domain 1C (RBP2-like), Jumonji/ARID domain-containing protein 1C, lysine (K)-specific demethylase 5C, MRXSJ, Protein SmcX, Protein Xe169, Smcx homolog, X chromosome, SMCXselected cDNA on X, Smcy homolog, X-linked, Smcy homolog, X-linked (mouse), XE169JmjC domain-containing protein SMCX
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human SMCX (XP_011529128.1).,, Sequence:, ERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8242
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.