missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SLC6A2/NET/Noradrenaline transporter Polyclonal antibody specifically detects SLC6A2/NET/Noradrenaline transporter in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | SLC6A2/NET/Noradrenaline transporter |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | NAT1neurotransmitter transporter, NET, NET1sodium-dependent noradrenaline transporter, Norepinephrine transporter, SLC6A5, solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2, Solute carrier family 6 member 2, solute carrier family 6 member 5 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLA |
| Purification Method | Protein A purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?