missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC6A19 Antibody, R&D Systems™

SLC6A19 Antibody, R&D Systems™

Artikelnummer. 18613116 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Quantity:
25 μL
0.1 mL
Packungsgröße:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity Packungsgröße
18613116 25 μL 25µL
18674815 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18613116 Lieferant Novus Biologicals Lieferanten-Nr. NBP24878425ul
 Restricted Item
Estimated Shipment: 02-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SLC6A19 Polyclonal specifically detects SLC6A19 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen SLC6A19
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias B0AT1, FLJ20680, FLJ34635, HND, sodium-dependent amino acid transporter system B0, sodium-dependent neutral amino acid transporter B(0)AT1, solute carrier family 6 (neurotransmitter transporter), member 19, solute carrier family 6 (neutral amino acid transporter), member 19, Solute carrier family 6 member 19, System B(0) neutral amino acid transporter AT1, system B0 neutral amino acid transporter
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNK
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 340024
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.