missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30499887

SLC20A1 Antibody [mFluor Violet 450 SE], Novus Biologicals Biologicals™

Product Code. 30499887 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30499887 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30499887 Supplier Novus Biologicals Supplier No. NBP338075MFV450

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beschreibung

Rabbit Polyclonal Antibody

SLC20A1 Polyclonal antibody specifically detects SLC20A1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen SLC20A1
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate mFluor Violet 450 SE
Formulation 50mM Sodium Borate
Gene Alias FLJ41426, Gibbon ape leukemia virus receptor 1, Glvr-1, GLVR1DKFZp686J2397, Leukemia virus receptor 1 homolog, Phosphate transporter 1, PiT-1PIT1, sodium-dependent phosphate transporter 1, solute carrier family 20 (phosphate transporter), member 1, Solute carrier family 20 member 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 257-356 of human SLC20A1 (NP_005406.3).,, Sequence:, KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPN
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6574
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.