missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SKIV2L2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84995-25ul
This item is not returnable.
View return policy
Beschreibung
SKIV2L2 Polyclonal specifically detects SKIV2L2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spezifikation
| SKIV2L2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| P42285 | |
| MTREX | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTK | |
| Affinity Purified | |
| RUO | |
| 23517 | |
| Human, Mouse, Rat | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ATP-dependent helicase SKIV2L2, Dob1, EC 3.6.1, EC 3.6.4.13, fSAP118, KIAA0052functional spliceosome-associated protein 118, MGC142069, Mtr4superkiller viralicidic activity 2-like 2, superkiller viralicidic activity 2-like 2 (S. cerevisiae) | |
| Rabbit | |
| 118 kDa | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering