missing translation for 'onlineSavingsMsg'
Learn More

Septin-4 Antibody [DyLight 405], Novus Biologicals Biologicals™

Product Code. 30499794 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30499794 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30499794 Supplier Novus Biologicals Supplier No. NBP335109V

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Septin-4 Polyclonal antibody specifically detects Septin-4 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Septin-4
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate DyLight 405
Formulation 50mM Sodium Borate
Gene Alias Apoptosis-related protein in the TGF-beta signaling pathway, ARTSPeanut-like protein 2, BRADEION, Bradeion beta, Brain protein H5, CE5B3, Cell division control-related protein 2, Cerebral protein 7, H5, hCDCREL-2SEP4, hucep-7, MART, peanut-like 2, peanut-like 2 (Drosophila), PNUTL2CE5B3 beta, septin 4, septin-4, septin-M
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin-4 (NP_536341.1).,, Sequence:, MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSE
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 5414
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.