missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500590

SEC61B Antibody [PerCP], Novus Biologicals Biologicals™

Product Code. 30500590 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500590 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500590 Supplier Novus Biologicals Supplier No. NBP337978PCP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SEC61B Polyclonal antibody specifically detects SEC61B in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SEC61B
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate PerCP
Formulation PBS
Gene Alias protein translocation complex beta, protein transport protein SEC61 beta subunit, protein transport protein Sec61 subunit beta, Sec61 beta subunit, Sec61 complex, beta subunit, SEC61B
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1).,, Sequence:, MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Membrane Trafficking and Chaperones
Primary or Secondary Primary
Gene ID (Entrez) 10952
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.