missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
REEP5 Polyclonal antibody specifically detects REEP5 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | REEP5 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 549 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | C5orf18polyposis coli region hypothetical protein DP1, chromosome 5 open reading frame 18, D5S346deleted in polyposis 1, DP1TB2YOP1, MGC70440, Polyposis locus protein 1, Protein TB2, receptor accessory protein 5, receptor expression enhancing protein 5, receptor expression-enhancing protein 5 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-189 of human REEP5 (NP_005660.4).,, Sequence:, FLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?