missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat RAP Protein

A cDNA sequence encoding the RAP was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13264-20ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15953019

  • 212.00 € / 20µg
Estimated Shipment: 24-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

RAP Protein
Research Use Only
Recombinant Protein
E. coli
MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Greater than 95.0% as determined by SDS-PAGE.
20 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Rat
His
The protein (1 mg/ml) was lyophilized after from a sterile solution containing TBS pH 7.5, 0.1% BSA and 0.09% NaN3.
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions