missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Pramlintide Protein

A cDNA sequence encoding the Pramlintide was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13132-1mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15952599

  • 137.00 € / 1mg
Estimated Shipment: 17-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

Pramlintide Protein
Research Use Only
Recombinant Protein
E. coli
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
Untagged
The protein was lyophilized with no additives.
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions