missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MARC2. Rabbit anti-Human, Polyclonal Antibody, Abnova™
Description
Sequence: RFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTL
Specifications
Specifications
| Antigen | MARC2. |
| Applications | Immunohistochemistry (PFA fixed) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Description | Rabbit polyclonal antibody raised against recombinant MARC2. |
| Dilution | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Formulation | In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide) |
| Gene | MARC2 |
| Gene Alias | MOSC2/RP11-270A6.1 |
| Gene Symbols | MARC2 |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?