missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PYK2/FAK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-91228
This item is not returnable.
View return policy
Description
PYK2/FAK2 Polyclonal specifically detects PYK2/FAK2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PYK2/FAK2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| CADTKCAK-beta, CAK beta, CAKB, Calcium-dependent tyrosine kinase, Cell adhesion kinase beta, EC 2.7.10, FADK2, FAK2EC 2.7.10.2, Focal adhesion kinase 2, PKB, Proline-rich tyrosine kinase 2, protein kinase B, protein tyrosine kinase 2 beta, protein-tyrosine kinase 2-beta, PTK, PTK2B protein tyrosine kinase 2 beta, PYK2Related adhesion focal tyrosine kinase, RAFTKFADK 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PTK2B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM | |
| 0.1 mL | |
| Angiogenesis, Apoptosis, Cancer, Cellular Markers, Protein Kinase, Signal Transduction, Tyrosine Kinases | |
| 2185 | |
| Human, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction