missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRDM16/MEL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56472-25ul
This item is not returnable.
View return policy
Description
PRDM16/MEL1 Polyclonal specifically detects PRDM16/MEL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| PRDM16/MEL1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| MDS1/EVI1-like gene 1, MEL1KIAA1675PFM13MGC166915, PR domain containing 16, PR domain zinc finger protein 16, PR domain-containing protein 16, Transcription factor MEL1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| PRDM16 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YKVIKDIEPGEELLVHVKEGVYPLGTVPPGLDEEPTFRCDECDELFQSKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQAHECKDCERMFPNKYS | |
| 25 μL | |
| Chromatin Research | |
| 63976 | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction