missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PITX3 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94198-0.1ml
This item is not returnable.
View return policy
Description
PITX3 Polyclonal antibody specifically detects PITX3 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| PITX3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| CTPP4, Homeobox protein PITX3, MGC12766, paired-like homeodomain 3, Paired-like homeodomain transcription factor 3, pituitary homeobox 3, PTX3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PITX3 (NP_005020.1). MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFT | |
| 0.1 mL | |
| Neurodegeneration, Neuroscience | |
| 5309 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction