missing translation for 'onlineSavingsMsg'
Learn More

PICK1 Antibody [Biotin], Novus Biologicals Biologicals™

Product Code. 30500353 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500353 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500353 Supplier Novus Biologicals Supplier No. NBP335510B

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PICK1 Polyclonal antibody specifically detects PICK1 in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen PICK1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Biotin
Formulation PBS
Gene Alias alpha binding protein, dJ1039K5, MGC15204, PICK, PRKCA-binding protein, PRKCABPprotein interacting with PRKCA, Protein interacting with C kinase 1, protein interacting with PRKCA 1, Protein kinase C-alpha-binding protein
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PICK1 (NP_036539.1).,, Sequence:, YLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Signal Transduction, Transcription Factors and Regulators, Vision
Primary or Secondary Primary
Gene ID (Entrez) 9463
Target Species Human
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.