missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16132685

PGA5, Mouse anti-Human, Clone: 4G9, Abnova™

Product Code. 16132685
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16132685 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16132685 Supplier Abnova Supplier No. H00005222M02/DEL

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Sequence: WNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGD

Specifications

Antigen PGA5
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 4G9
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene pepsinogen 5, group I (pepsinogen A)
Gene Accession No. NM_014224
Gene Alias -
Gene Symbols PGA5
Host Species Mouse
Immunogen PGA5 (NP_055039, 203 a.a. ∼ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5222
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.