missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pea3 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
213.00 € - 507.00 €
Specifications
| Antigen | Pea3 |
|---|---|
| Dilution | Western Blot 1:2000 - 1:9000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232540
|
Novus Biologicals
NBP3-33399-100ul |
100 μL |
507.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232356
|
Novus Biologicals
NBP3-33399-20ul |
20 μL |
213.00 €
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Pea3 Monoclonal antibody specifically detects Pea3 in Human samples. It is validated for ELISA,Western BlotSpecifications
| Pea3 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 2118 | |
| IgG | |
| Affinity purified |
| Western Blot 1:2000 - 1:9000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| Adenovirus E1A enhancer-binding protein, E1A-FE1A enhancer binding protein, E1AFETS translocation variant 4, ets variant 4, ets variant gene 4 (E1A enhancer binding protein, E1AF), ets variant gene 4 (E1A enhancer-binding protein, E1AF), EWS protein/E1A enhancer binding protein chimera, PEA3, PEAS3, Polyomavirus enhancer activator 3 homolog, polyomavirus enhancer activator-3, Protein PEA3 | |
| A synthetic peptide corresponding to a sequence within amino acids 384-484 of human Pea3 (NP_001977.1).,, Sequence:, QKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title