missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pax3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-32381
This item is not returnable.
View return policy
Description
Pax3 Polyclonal specifically detects Pax3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Pax3 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| CDHS, HuP2, HUP2MGC120384, MGC120381, MGC120382, MGC120383, MGC134778, paired box 3, paired box gene 3 (Waardenburg syndrome 1), paired box homeotic gene 3, paired box protein Pax-3, paired domain gene 3, paired domain gene HuP2, Waardenburg syndrome 1, WS1, WS3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PAX3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSL | |
| 0.1 mL | |
| Apoptosis, Mesenchymal Stem Cell Markers, Neuronal Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators | |
| 5077 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction