missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PABPN1 Polyclonal antibody specifically detects PABPN1 in Human, Mouse samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | PABPN1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:1000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | Nuclear poly(A)-binding protein 1, OPMD, PAB2poly(A) binding protein II, PABII, PABP-2, PABP2polyadenylate-binding protein 2, poly(A) binding protein 2, poly(A) binding protein, nuclear 1, Poly(A)-binding protein 2, Poly(A)-binding protein II, poly(A)-binding protein, nuclear 1, Polyadenylate-binding nuclear protein 1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PABPN1 (NP_004634.1). MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?