missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Osteopontin/OPN Antibody (CL10686), Novus Biologicals™
Mouse Monoclonal Antibody
299.00 € - 570.00 €
Specifications
| Antigen | Osteopontin/OPN |
|---|---|
| Clone | CL10686 |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18625488
|
Novus Biologicals
NBP3-07980-100ul |
100 μg |
570.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18668578
|
Novus Biologicals
NBP3-07980-25ul |
25 μg |
299.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Osteopontin/OPN Monoclonal antibody specifically detects Osteopontin/OPN in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Osteopontin/OPN | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| BNSP, Bone sialoprotein 1, MGC110940, Nephropontin, osteopontin, secreted phosphoprotein 1bone sialoprotein I, early T-lymphocyteactivation 1), secreted phosphoprotein-1 (osteopontin, bone sialoprotein), SPP-1, SPP1/CALPHA1 fusion, Urinary stone protein, uropontin | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDAT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| CL10686 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Apoptosis, Biologically Active Proteins, Cancer, Cellular Markers, Extracellular Matrix, Hypoxia | |
| PBS, pH 7.2, containing 40% glycerol | |
| 6696 | |
| IgG1 | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title