missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NUDT1 (Human) Recombinant Protein

Human NUDT1 full-length ORF ( AAH14618, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00004521-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16138001

Estimated Shipment: 04-09-2024
to see stock.

Description

Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Specifications

Accession Number	AAH14618
Name	nudix (nucleoside diphosphate linked moiety X)-type motif 1
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	NUDT1
Protein Tag	GST

Gene ID (Entrez)	4521
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	MTH1
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description