missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NUCKS1 Polyclonal antibody specifically detects NUCKS1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | NUCKS1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 594 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | FLJ21480, FLJ32016, FLJ38536, NUCKSnuclear ubiquitous casein and cyclin-dependent kinases substrate, nuclear casein kinase and cyclin-dependent kinase substrate 1, nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate, P1, potential LAG1 interactor |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NUCKS1 (NP_073568.2).,, Sequence:, ASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKE |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?