missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NHLH1 (Human) Recombinant Protein

Human NHLH1 full-length ORF ( AAH13789, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00004807-P01.10ug

View more versions of this product

Product Code. 16138381

344.00 € / 10µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Sequence: MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Specifications

Accession Number	AAH13789
Name	nescient helix loop helix 1
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	NHLH1
Protein Tag	GST

Gene ID (Entrez)	4807
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	HEN1, NSCL, NSCL1, bHLHa35
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Abnova™ NHLH1 (Human) Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Promotions